... Splice acceptor Phase of intron acag|gtaag tatg|gtaag tatg|gtaag agag|gtaag g(t)5aacag|aagaa c(t)4gtatacag|actc a( t)4cag|atcc c(t)4ag|aatc Not in coding region I I II (2929) (986) (1985) (1490) Table ... (5Â-CGGGATCCCAATCTGTTGCTAA TTAGG-3Â) and the 3Â specic oligonucleotides (5Â-GA AGATCTACCACACCTCCTCATCTCC-3Â) for amplication ofthe region from )180 to )36 and (5Â-GAAGAT CTAACTAGATTTTACCATTGG-3Â) for amplication of ... is associated with a calcium sensitive regulatory mechanism The amplitude ofthe observed transactivation and the effective range of calcium concentrations are similar to the data presented for...
... DDNPIGATLIGR ELLDGDEVDKa YPGVPYTFFAQR VSLYQDAHVPDNFIPKa VALMVWDDR DPDDGGSILQDLK IVVVDHELPR YDSAFHPLFSTLDSAHHDDFHQPNYAGASIAKa EPWHDIHSR SIDGGAAFGFPDTPEEASKa SIQDAYINAIR SDDIDVDEVGALHLIPKa DIVDALQDKa ... recombinant cardosin A with native cardosin A (Fig 2B) A Molecular cloning of C cardunculus L PLDa cDNA and characterization ofthe deduced amino-acid sequence To characterize further cardoon PLDa, ... raised against cabbage PLDa that cross-reacted with our 90-kDa cardosin A- binding protein (Fig 1B) After the identification of cardoon PLDa as a cardosin Abinding protein, we examined whether cardosin...
... ACER values were recalculated maintaining the observed drug prescription practices Data entry and analysis Morbidity data was entered and analysed in STATA version Cost data was entered and analysed ... reduced the costs of case correctly diagnosed Strengths This study was conducted within the actual malaria context using field-based data in a malarious population The advantage of field-based ... falciparum 2002 malaria in Uganda Trans R Soc Trop Med Hyg 2002, 96:254-257 Mendiratta DK, Bhutada K, Narang R, Narang P: Evaluation of different methods for diagnosis of P falciparum malaria Indian...
... triangular acini share a common base and comprise a diamond with central veins at the tips ofthe long axis and portal triads at the tips ofthe short axis Adjacent acini extend into adjacent liver ... manuscript LZ and AH assisted with method development and collection of images FB and IR assisted in the preparation ofthe manuscript All authors read and approved the final manuscript Competing ... Microanalysis Research Facility) at the Australian Centre for Microscopy & Microanalysis, The University of Sydney Author details Faculty of Pharmacy, University of Sydney, NSW 2006, Australia 2Australian...
... read and approved the final manuscript Additional data files The following additional data are available with the online version of this paper Additional data file shows the comparison ofthe ... contributions AJP, ATP and MBR designed the study ATP, KAM, TPS and EIA carried out the analyses, calculations and performed the statistical analyses AJP, ATP and MBR prepared the manuscript All authors ... repeats for each individual gene cluster is shown in detail in Additional data file 2a, b; the statistical analysisof these data is shown in Additional data file 5a, b) In the orthologous imprinted...
... Alexandria University Author details Department of Mathematics, Faculty of Education, Alexandria University, Alexandria, Egypt 2Faculty of Industrial Education, Helwan University, Cairo, Egypt Authors’ ... contributions The two authors typed read and approved the final manuscript also they contributed to each part of this work equally Competing interests The authors declare that they have no competing ... equiconvergence ofthe eigenfunction expansion ofa singular boundary value problem.Az,NEENTE, No.96AZ -D, 1983 Nimark, MA: The study of eigenfunction expansion of non-self adjoint differential operator of the...
... Alexandria University Author details Department of Mathematics, Faculty of Education, Alexandria University, Alexandria, Egypt 2Faculty of Industrial Education, Helwan University, Cairo, Egypt Authors’ ... contributions The two authors typed read and approved the final manuscript also they contributed to each part of this work equally Competing interests The authors declare that they have no competing ... equiconvergence ofthe eigenfunction expansion ofa singular boundary value problem.Az,NEENTE, No.96AZ -D, 1983 Nimark, MA: The study of eigenfunction expansion of non-self adjoint differential operator of the...
... obtained by Hashimoto [5] Bass proved the second identity by using a linear algebraic method Stark and Terras [9] gave an elementary proof of this formula, and discussed three different zeta functions ... fundamental group of G was developed by Sunada [11,12] Hashimoto [4] treated multivariable zeta functions of bipartite graphs Bass [2] generalized Ihara’s result on the zeta function ofa regular ... functions of graphs, and showed that the reciprocals of zeta functions of regular graphs are explicit polynomials A zeta function ofa regular graph G associated with a unitary representation of the...
... originally obtained as Cbl-saturated holo-forms, and preparation ofthe unsaturated apo-forms required their denaturing Unfolding of TC with m guanidine hydrochloride (GdnHCl) was earlier found to ... the afnity fora ligand is decreased by a factor of 106 (e.g., to Kd ẳ 110 nm) Additional observation indicates that the reduced afnity forthe analogue CBC had no effect on the recognition of ... 5A Already a rough comparison ofthe dissociation velocities indicated at least a 10-fold faster liberation ofthe uorescent analogue when compared with Cbl The CBC dissociation spanned at least...
... E GAG A GCC T ACC L TTG A GCC Y TAC E GAG D GAC H CAC D GAC Q CAG A GCA S AGC V GTC S TCC A GCT N AAC K AAG A GCG N AAC E GAG Y TAC D GAC K AAG L CTA K AAG Q CAG L CTC G GGC G GGG E GAG E GAG ... AGAD AADA.NA.VG D. D 113 Zea AYA.S A- QRQG LI GG FW AGAD.SASDA.GS.VS QY.DHDT.S 112 Nicotiana AYA.N S-Q.AA NL HGQ AE -GDFMTAAKA.EM.V QY.DHD 118 Cyn d 24 DQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKDTMIMCSYWPPGNYENQKPY ... the immobilized antigen After washes, alkaline phosphatase-conjugated mouse antihuman IgE antibody (1000-fold diluted) was added for h at 37 °C, the alkaline phosphatase activity was measured...
... building adaptations and additions, and spectacles and contact lenses also had to be excluded What we did This study involved a combination of desk research and interviews with a number of key ... Institute for Ageing and Health–Years Ahead Partnership that funding has been secured fora feasibility study aimed at establishing a recognised product accreditation and approval scheme for Independent ... satisfactorily for consumers to the regulators and the Office of Fair Trading We are interested in seeing further analysisofthe issues by the OFT Equipment for older and disabled people: an analysisof the...
... This variable was coded as a one if they did make a counterfeit purchase, and a zero if they did not If they “didn’t know” then they were excluded from theanalysis This variable was the dependent ... legitimate goods Ang et al (2001) surveyed a total 3,621 respondents, aged 15 and above, who had purchased CDs in the past The results indicated that one’s attitude towards piracy was a significant ... to females Education level Education level was measured based on the students’ year in school Three dummy variables were created A dummy variable was assigned a value of one for each ofthe following...
... indicated in the figure legends (with pPac added to a total of 5.75 lg), and harvested days after transfection CAT and b-galactosidase activities were measured in extracts of transfected cells [24], and ... with medium until harvested days after transfection Sendai virus was added forthe last 18 h of transfection Sendai virus was obtained from SPAFAS (North Franklin, CT, USA) and used at 200 hemagglutinin ... normal Arbitrary units rather than fold activation was used in most Figures herein so that the relative strength of reporters can be compared Basal activity ofa reporter displayed the most variation...
... to the solvent and may therefore act as a gate forthe possible exit ofa watercoordinated proton occurring at the extra-cytoplasmic end ofthe proton transfer path 3D modelling of Neurospora ... aspartate (Asp378 in PMA1_NEUCR), several cavities are also seen at the same position in ATC1_RABIT (data not shown) Aside from mutations directed against a small stretch of amino acids adjacent to the ... fold of this domain is remarkably conserved between the Ca2+-ATPase and the soluble members ofthe haloacid dehalogenases whose catalytic activity proceed essentially by the same mechanism Indeed,...
... Kingdom Department for International Development) The team also appreciated the advice ofthe Honorable Barry O’Keefe (retired Chief Judge ofthe Commercial Division and an Additional Judge of Appeal ... Mexico; the Netherlands; Nigeria; the Philippines; Singapore; St Kitts and Nevis; St Lucia; Switzerland; Tanzania; Trinidad and Tobago; the United Kingdom; the United States; Uruguay; and Zambia attended ... Guatemala, Haiti, Indonesia, Mexico, Morocco, Nigeria, Panama, Paraguay, Peru, the Philippines, St Kitts and Nevis, St Lucia, St Vincent and the Grenadines, Tanzania, and Trinidad and Tobago 14 Practitioners...
... OECD countries on the user cost of R &D, and they concluded that a dollar in tax credit for R &D stimulated a dollar of additional R &D Bloom, Griffith and Reenen (2000) examined the impact of fiscal ... Japan, United Kingdom and the Netherlands appeared to be more generous for small firms Finland and Germany displayed negative tax subsidy rate1 both for large firms and SMEs (The value of tax ... due to the lagged endogenous variable is among the right-hand side variables of equation However, in theanalysisof this thesis, country dummies are also included, because ofthe advantage of...
... Real Federal Non-Medicaid Grants to State and Local Governments CDA analysts made an adjustment to the GI variable (GFAIDSLOR) that measures real federal non-Medicaid grants to state and local ... Committee CDA analysts made an adjustment to the GI variable (GFAIDSLSSMEDR) that measures the real federal Medicaid grants to state and local governments by deflating the nominal dollar difference The ... percent of GDP was applied to the adjusted GI long-term model baseline Then, the nominal dollar change was adjusted to real dollar change by dividing by the relevant price deflator for that GI variable...
... National Standard directed at bycatch calling forthe minimization of bycatch and the minimization ofthe mortality of bycatch Finally, it directed that each FMP must include a standardized reporting ... Conservation and Management Act National Standards - The Fishery Conservation and Management Act requires that a fishery management plan and its regulations meet ten standards The ten national standards ... usually estimated from relative abundance, although other methods may be used Abundance - See relative abundance and absolute abundance Acceptable Biological Catch (ABC) - A term used by a management...